PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC05G14460.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 643aa    MW: 68547.9 Da    PI: 8.1659
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC05G14460.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_139.71.1e-12167228162
                      XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                      e++ +r+ r+++NRe+A+ sRqRKk ++eeLeekvk++ +   +L ++++    e a+l+++
  OPUNC05G14460.1 167 EEDKRRAARLMRNRESAQLSRQRKKRYVEELEEKVKSMHSVINDLNSRISFVVAENATLRQQ 228
                      5677899*********************************9999***999888888888877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.0E-14166231IPR004827Basic-leucine zipper domain
PfamPF001701.1E-10168229IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.979169229IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.3E-15171230No hitNo description
SuperFamilySSF579591.69E-11171229No hitNo description
CDDcd147046.18E-20172223No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 643 aa     Download sequence    Send to blast
MAEPALLDPS AFDLRLYPAH LFDHELPLGG GGGDDDDLPL DGLEFDLPGD FSVEDFLLRS  60
PERDDSGEGS AAGSGPTASP SSSPTTSASN SAVANGSGGE VKHEESDEGR SGEADPKWSL  120
KRKQASPGLS SDAAKCRRSG DGDVSPSASA SRTAVDSDEG GTVCEEEEDK RRAARLMRNR  180
ESAQLSRQRK KRYVEELEEK VKSMHSVIND LNSRISFVVA ENATLRQQLS GGSVNCPPPG  240
VYPPVPIPGM HFPWVPGYAM RPPGSHVPLV PIPRLKPQQP APASKVAKKP ESKKTVENKC  300
KSKTKTKKVA SVSLLGLLLL MLVFGAFIPG FNHNFGMGGQ SDNAMFRNFG QSHARVLSVS  360
SQDKSSLNNS DMIGVDVRKM TGNTDGPGKK HQPAHNSSEI LPALLYVPRN GKHVKINGNL  420
IIHSVLASEK AVAHKASKGD SDQSAKDHKE TSVAIARYLS LPGKDVNRQE TSSADGPLPQ  480
WFREGMEGSI LSSGMCSEVF QFDISTASSN HGGIIPASPV VNSTSVNATE KIPAHSAAYH  540
GKLKNRRVMY NEAIPLTGKT VNNTEPFNRT SESSSKLPDS KPASSVVVSV LADPREAGNG  600
DGDPRVSPKP LSKIFVVVLV DGARYVTYSC TLPFKSASPH LVN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1169191KRRAARLMRNRESAQLSRQRKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0731420.0AK073142.1 Oryza sativa Japonica Group cDNA clone:J033024D10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640085.10.0PREDICTED: bZIP transcription factor 17
TrEMBLA0A0E0L2I40.0A0A0E0L2I4_ORYPU; Uncharacterized protein
STRINGORGLA05G0141100.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82283545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.12e-91bZIP family protein